PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C00826.1.p
Common NameEUGRSUZ_C00826, LOC104436430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 326aa    MW: 36010.7 Da    PI: 6.5114
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C00826.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT++Ed +l +++k +G g+W+  +++ g+ R++k+c++rw++yl
  Eucgr.C00826.1.p 14 RGAWTAQEDRILTNYIKAHGEGRWRNLPKKAGLQRCGKSCRLRWLNYL 61
                      89********************************************97 PP

2Myb_DNA-binding53.17.3e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ +++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
  Eucgr.C00826.1.p  67 RGNISPDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                       7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.281961IPR017930Myb domain
SuperFamilySSF466891.61E-2812108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002498.0E-141461IPR001005SANT/Myb domain
CDDcd001676.65E-111661No hitNo description
PROSITE profilePS5129425.60162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2465116IPR009057Homeodomain-like
SMARTSM007174.0E-1666114IPR001005SANT/Myb domain
PfamPF002494.5E-1567112IPR001005SANT/Myb domain
CDDcd001675.80E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTAQ EDRILTNYIK AHGEGRWRNL PKKAGLQRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGRKVQSNT  120
PTNSQSRSGH VDQLSPNHQR DDDRPRKVKS PRHSETSKMS TDDNSASESP SSKPDARSVK  180
TNAFKCSKVL IDPPPEQELH RNEDPINTDF AASAAVDPAP TGVLPPFTGN IPADLSMDDF  240
EIGDICLSEF LNSDTSSIAN QGQFNSNNSI TISDDLFADD SQVQGLGWAA LSSDSVPDNH  300
QANAGPNFHQ AFASFLDYNG GDQWL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C00826.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9113411e-70AB911341.1 Vitis vinifera MYBPAR mRNA for R2R3 MYB transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047497.10.0PREDICTED: myb-related protein 330-like
TrEMBLA0A059CLX40.0A0A059CLX4_EUCGR; Uncharacterized protein
STRINGGLYMA13G16890.12e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.13e-64myb domain protein 3